To explore the effect of Adrenomedullin (AM) (1-52), human on astroglioma cells, CRT-MG cells are incubated in the absence or presence of Adrenomedullin (AM) (1-52), human (ADM1-52) for 48 h in a medium containing 1% FBS, and wound-healing assay is performed. The number of cells migrating to the wound region significantly increases in the ADM1-52-treated cells, in a dose-dependent manner, compared to the untreated cells^[1] .

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

6142.76

C???H???F?N??O??S?

Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21)

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys16-Cys21)

Room temperature in continental US; may vary elsewhere.

Powder-80°C2 years-20°C1 yearIn solvent-80°C6 months-20°C1 month

In Vitro: 

H₂O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

 ContentsAssign valueAcidic amino acidAsp (D), Glu (E), and the C-terminal -COOH.-1Basic amino acidArg (R), Lys (K), His (H), and the N-terminal -NH2+1Neutral amino acidGly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q)0

3.  Recommended solution:

Overall charge of peptideDetailsNegative (<0)1.  Try to dissolve the peptide in water first.2.  If water fails, add NH4OH (<50 μL).3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.Positive (>0)1.  Try to dissolve the peptide in water first.2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.Zero (=0)1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.

• [1]. Lim SY, et al. Transcriptional regulation of adrenomedullin by oncostatin M in human astroglioma cells: implications for tumor invasion and migration. Sci Rep. 2014 Sep 23;4:6444.