|
Description
|
Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively[1] [2] .
|
|
IC50 & Target
|
pEC50: 11.46 (human CRF1, CHO cells), 9.36 (human CRF2, CHO cells), 9.85 (rat CRF2α, CHO cells)[1]
Ki: 0.4 nM (hCRF1, cell assay), 1.8 nM (rCRF2α, cell assay), and 5.7 nM (mCRF2β, cell assay)[2]
|
|
In Vitro
|
Urotensin I is 2-3 times more potent than CRF or sauvagine in stimulating ACTH release from a superfused goldfish anterior pituitary cell column[3] .
Rat tail artery strips were incubated in the presence of 4 x 10(-3) M theophylline and Urotensin I (UI). At the concentrations of 1.50, 7.50 mU/ml but not of 0.75 mU/ml Urotensin I, the content of cAMP increased significantly[4] .
MCE has not independently confirmed the accuracy of these methods. They are for reference only.
|
|
In Vivo
|
Intraperitoneal injections of urotensin I, a CRF-like neuropeptide isolated from the caudal neurosecretory system of the teleost Catostomus commersoni, ovine CRF and sauvagine all produced significant increases in circulating levels of plasma cortisol in goldfish in which endogenous ACTH secretion was suppressed with betamethasone[3] .
MCE has not independently confirmed the accuracy of these methods. They are for reference only.
|
|
Molecular Weight
|
|
|
Formula
|
|
|
Sequence
|
Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2
|
|
Sequence Shortening
|
NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
|
|
Shipping
|
Room temperature in continental US; may vary elsewhere.
|
|
Storage
|
|
Powder
|
-80°C
|
2 years
|
|
|
-20°C
|
1 year
|
|
In solvent
|
-80°C
|
6 months
|
|
|
-20°C
|
1 month
|
|
|
References
|
-
[1]. Smart D, et al. Characterisation using microphysiometry of CRF receptor pharmacology. Eur J Pharmacol. 1999 Aug 27;379(2-3):229-35.
[2]. Reul JM, et al. Corticotropin-releasing factor receptors 1 and 2 in anxiety and depression. Curr Opin Pharmacol. 2002 Feb;2(1):23-33.
[3]. Fryer J, et al. Urotensin I, a CRF-like neuropeptide, stimulates acth release from the teleost pituitary. Endocrinology. 1983;113(6):2308-2310.
[4]. Gerritsen ME, et al. Urotensin I effects on intracellular content of cyclic AMP in the rat tail artery. Eur J Pharmacol. 1979;60(2-3):211-220.
|